Antibodies

View as table Download

SGCD mouse monoclonal antibody,clone OTI3D9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

delta Sarcoglycan (SGCD) mouse monoclonal antibody, clone AT19G8, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

delta Sarcoglycan (SGCD) mouse monoclonal antibody, clone AT19G8, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Goat Anti-Delta-Sarcoglycan (aa245-257) Antibody

Applications WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RLPHGSYTPTGTR, from the internal region of the protein sequence according to NP_000328.2; NP_758447.1; NP_001121681.1.

Rabbit Polyclonal Anti-Sgcd Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sgcd antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQ