Carrier-free (BSA/glycerol-free) ANO1 mouse monoclonal antibody,clone OTI1C6
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANO1 mouse monoclonal antibody,clone OTI1C6
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) ANO1 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANO1 mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) ANO1 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANO1 mouse monoclonal antibody, clone OTI5H7 (formerly 5H7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ANO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ANO1 |
Rabbit Polyclonal Anti-TMEM16A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMEM16A antibody: synthetic peptide directed towards the middle region of human TMEM16A. Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY |
ANO1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ANO1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ANO1 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ANO1 mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ANO1 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ANO1 (Dog1/TMEM16A) mouse monoclonal antibody, clone UMAB250
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal TMEM16A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TMEM16A antibody was raised against a 17 amino acid peptide from near the amino terminus of human TMEM16A. |
Rabbit Polyclonal DOG1/TMEM16A Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |