Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) ANO1 mouse monoclonal antibody,clone OTI1C6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) ANO1 mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ANO1 mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) ANO1 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ANO1 mouse monoclonal antibody, clone OTI5H7 (formerly 5H7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-ANO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANO1

Rabbit Polyclonal Anti-TMEM16A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM16A antibody: synthetic peptide directed towards the middle region of human TMEM16A. Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY

Rabbit Polyclonal TMEM16A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TMEM16A antibody was raised against a 17 amino acid peptide from near the amino terminus of human TMEM16A.

Rabbit Polyclonal DOG1/TMEM16A Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.