Rabbit Polyclonal Anti-ATP7A Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP7A antibody: synthetic peptide directed towards the middle region of human ATP7A. Synthetic peptide located within the following region: SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL |
Rabbit Polyclonal Anti-ATP7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP7A antibody: synthetic peptide directed towards the N terminal of human ATP7A. Synthetic peptide located within the following region: MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ |
Rabbit Polyclonal Anti-ATP7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP7A antibody is: synthetic peptide directed towards the middle region of Human ATP7A. Synthetic peptide located within the following region: MGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH |
Germany
Japan
United Kingdom
China
