Antibodies

View as table Download

Anti-EDA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 284-298 amino acids of Human Ectodysplasin-A

Rabbit Polyclonal Anti-EDA Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EDA

Anti-EDA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 284-298 amino acids of Human Ectodysplasin-A

EDA Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human EDA

Rabbit Polyclonal Anti-EDA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EDA Antibody: synthetic peptide directed towards the middle region of human EDA. Synthetic peptide located within the following region: GPPGPPGPQGPPGLQGPSGAADKAGTRENQPAVVHLQGQGSAIQVKNDLS

Rabbit Polyclonal Anti-EDA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EDA Antibody: synthetic peptide directed towards the middle region of human EDA. Synthetic peptide located within the following region: HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY

Rabbit Polyclonal Anti-Eda Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Eda Antibody is: synthetic peptide directed towards the C-terminal region of Rat Eda. Synthetic peptide located within the following region: FASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVH