Antibodies

View as table Download

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

BCL2 Rabbit monoclonal antibody,clone OTIR1C12

Applications IHC
Reactivities Human
Conjugation Unconjugated

BCL2 Rabbit monoclonal antibody,clone OTIR1H2

Applications IHC
Reactivities Human
Conjugation Unconjugated

BCL2 Rabbit monoclonal antibody,clone OTIR3F2

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.

Rabbit Polyclonal Anti-FZD7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Anti-BAX Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein

Anti-BCL2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-54 amino acids of Human B-cell CLL/lymphoma 2

Rabbit polyclonal TGFBR2 (Ab-250) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I).

Rabbit polyclonal anti-PDGFR a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PDGFR a.

Anti-ACVR1B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 218-381 amino acids of human activin A receptor, type IB

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal TGFBR2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2.