Antibodies

Jump to Filters
View as table Download
FBP1 Rabbit Polyclonal Antibody
TA349970

USD 380.00

In Stock

Rabbit Polyclonal Anti-FBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FBP1
FBP1 Rabbit Polyclonal Antibody
TA346042

USD 485.00

5 Days

Rabbit Polyclonal Anti-FBP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
FBP1 Rabbit Polyclonal Antibody
TA332672

USD 365.00

3 Weeks

Rabbit anti-FBP1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FBP1