Antibodies

Jump to Filters
View as table Download
GNLY Mouse Monoclonal Antibody [Clone ID: B-L38]
AM31287PU-N

USD 335.00

2 Weeks

GNLY mouse monoclonal antibody, clone B-L38, Purified

Applications FC
Reactivities Human
Conjugation Unconjugated
GNLY (N-term) Rabbit Polyclonal Antibody
AP51884PU-N

USD 580.00

2 Weeks

GNLY (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 13-43 amino acids from the N-terminal region of Human GNLY
GNLY Rabbit Polyclonal Antibody
TA346467

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNLY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNLY antibody: synthetic peptide directed towards the n terminal of human GNLY. Synthetic peptide located within the following region: TRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIPSTG
GNLY Mouse Monoclonal Antibody [Clone ID: B-R32]
AM31288AF-N

USD 370.00

2 Weeks

GNLY mouse monoclonal antibody, clone B-R32, Azide Free

Reactivities Human
Conjugation Unconjugated
GNLY Mouse Monoclonal Antibody [Clone ID: B-L38]
AM31287AF-N

USD 370.00

2 Weeks

GNLY mouse monoclonal antibody, clone B-L38, Azide Free

Reactivities Human
Conjugation Unconjugated