Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PLG mouse monoclonal antibody,clone OTI4F5
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal PLG Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG. |
Plasminogen (PLG) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal anti-PLG antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PLG. |
Goat polyclonal Plasminogen antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen [Human Plasma] |
Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PLMN. |
Goat polyclonal Plasminogen antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen [Human Plasma] |
Rabbit Polyclonal Anti-PLG
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLG antibody: synthetic peptide directed towards the middle region of human PLG. Synthetic peptide located within the following region: LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE |
Active filters
Target Symbol
- PLASMINOGEN
Conjugates
- Unconjugated
Families
- Secreted Protein
Pathways
- Neuroactive ligand-receptor interaction