Antibodies

Jump to Filters
View as table Download
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]
CF809271

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13D7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA329505

USD 485.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]
TA809271S

USD 200.00

2 Days

GNAS mouse monoclonal antibody,clone OTI13D7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".