USD 380.00
2 Weeks
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRNA4 |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRNA4 |
USD 850.00
3 Weeks
Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha 4 (extracellular
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DLVNMHSRVDQLD, corresponding to amino acid residues 190-202 of human nAChRa4. Extracellular, N-terminus. |
USD 520.00
5 Days
Goat Polyclonal Antibody against CHRNA4 (aa29-43)
Applications | WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVETRAHAEERLLKK, from the internal region of the protein sequence according to NP_000735.1. |
USD 539.00
5 Days
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA4 antibody: synthetic peptide directed towards the N terminal of human CHRNA4. Synthetic peptide located within the following region: ELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKW |
USD 539.00
5 Days
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA4 antibody: synthetic peptide directed towards the N terminal of human CHRNA4. Synthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT |