Rabbit polyclonal anti-DLX5 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DLX5. |
Rabbit polyclonal anti-DLX5 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DLX5. |
DLX5 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DLX5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DLX5 Antibody: synthetic peptide directed towards the middle region of human DLX5. Synthetic peptide located within the following region: KEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAE |
Rabbit Polyclonal Anti-DLX5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLX5 antibody: synthetic peptide directed towards the C terminal of human DLX5. Synthetic peptide located within the following region: HPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY |
Goat Anti-DLX5 Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-AYNRVPSATNQPEK, from the internal region of the protein sequence according to NP_005212.1. |
Rabbit Polyclonal anti-DLX5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLX5 antibody: synthetic peptide directed towards the N terminal of human DLX5. Synthetic peptide located within the following region: NPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEK |