Germany
Japan
United Kingdom
China
Carrier-free (BSA/glycerol-free) SIGLEC7 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
SIGLEC7 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SIGLEC7 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SIGLEC7 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SIGLEC7 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SIGLEC7 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SIGLEC7 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIGLEC7 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIGLEC7 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIGLEC7 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIGLEC7 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SIGLEC7 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SIGLEC7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIGLEC7 antibody: synthetic peptide directed towards the middle region of human SIGLEC7. Synthetic peptide located within the following region: WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- SIGLEC 7
Reactivities
- Human
Conjugates
- Unconjugated
Families
- ES Cell Differentiation/IPS