Rabbit polyclonal antibody to RAD18 (RAD18 homolog (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 259 of RAD18 (Uniprot ID#Q9NS91) |
Rabbit polyclonal anti-RAD18 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD18. |
Rabbit Polyclonal Anti-RAD18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD18 antibody: synthetic peptide directed towards the middle region of human RAD18. Synthetic peptide located within the following region: KQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKT |
Rabbit Polyclonal Anti-RAD18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD18 antibody: synthetic peptide directed towards the middle region of human RAD18. Synthetic peptide located within the following region: LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI |
Rabbit anti-RAD18 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RAD18 |
Mouse Monoclonal RAD18 Antibody (79B1048.1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RAD18 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD18 Antibody: A synthesized peptide derived from human RAD18 |
Germany
Japan
United Kingdom
China
