JAK3 mouse monoclonal antibody,clone OTI1B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI1B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI2B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JAK3 mouse monoclonal antibody,clone OTI1B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JAK3 mouse monoclonal antibody,clone OTI2B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
JAK3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-JAK3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JAK3 Antibody is: synthetic peptide directed towards the N-terminal region of Human JAK3. Synthetic peptide located within the following region: APPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAE |
Rabbit Polyclonal Anti-JAK3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JAK3 Antibody: synthetic peptide directed towards the middle region of human JAK3. Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF |
Rabbit anti JAK3 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from the adjacent to C-terminus of JAK3 protein. This sequence is identical in JAK3 from human, rat and mouse origins. |
JAK3 mouse monoclonal antibody,clone OTI1B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
JAK3 mouse monoclonal antibody,clone OTI2B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".