Antibodies

Jump to Filters
View as table Download
AKR1C2 Rabbit Polyclonal Antibody
AP50131PU-N

USD 580.00

In Stock

Rabbit Polyclonal Anti-AKR1C2 Antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 295-323 amino acids from the C-terminal region of human AKR1C2
AKR1C2 Rabbit Polyclonal Antibody
TA313748

USD 380.00

In Stock

Rabbit polyclonal anti-AKR1C2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKR1C2.
AKR1C2 Rabbit Polyclonal Antibody
TA337629

USD 539.00

5 Days

Rabbit Polyclonal Anti-AKR1C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK
AKR1C2 Rabbit Polyclonal Antibody
TA337630

USD 539.00

5 Days

Rabbit Polyclonal Anti-AKR1C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
AKR1C2 Rabbit Polyclonal Antibody
TA354909

USD 425.00

5 Days

Rabbit anti ARK1C2 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated