Germany
Japan
United Kingdom
China
Antibodies
View as table Download
NAGA mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI7F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI8H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI7F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI8H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI3A4
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-NAGA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the N-terminal region of NAGA. Synthetic peptide located within the following region: GYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYA |
Rabbit Polyclonal Anti-NAGA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NAGA antibody is: synthetic peptide directed towards the middle region of Human NAGA. Synthetic peptide located within the following region: CFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLAD |
NAGA mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NAGA mouse monoclonal antibody,clone OTI7F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NAGA mouse monoclonal antibody,clone OTI8H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- NAGA
Reactivities
- Human
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Glycosphingolipid biosynthesis - globo series