Antibodies

Jump to Filters
View as table Download
Galactosidase alpha (GLA) (N-term) Rabbit Polyclonal Antibody
AP17424PU-N

USD 580.00

2 Weeks

Galactosidase alpha (GLA) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 90~120 amino acids from the N-terminal region of human GLA
Galactosidase alpha (GLA) Rabbit Polyclonal Antibody
TA336243

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-GLA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF