Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
TPM1 (Sarcomeric) mouse monoclonal antibody, clone ST-39, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
TPM1 (36Da) mouse monoclonal antibody, clone TM-36, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
TPM1 (36/39kDa) mouse monoclonal antibody, clone TM-33, Purified
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TPM1
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Cardiac muscle contraction