Antibodies

Jump to Filters
View as table Download
BMP8B Rabbit Polyclonal Antibody
TA313512

USD 380.00

In Stock

Rabbit polyclonal anti-BMP8B antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BMP8B.
BMP8B Rabbit Polyclonal Antibody
TA338265

USD 539.00

5 Days

Rabbit Polyclonal Anti-BMP8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP8B antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8B. Synthetic peptide located within the following region: CPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDL