Rabbit Polyclonal Anti-CCT5 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ZBTB2 |
Rabbit Polyclonal Anti-CCT5 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ZBTB2 |
ZBTB2 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ZBTB2 |
Rabbit Polyclonal ZBTB2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ZBTB2 antibody was raised against a 14 amino acid peptide near the center of human ZBTB2. |
Rabbit Polyclonal Anti-ZBTB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZBTB2 antibody: synthetic peptide directed towards the middle region of human ZBTB2. Synthetic peptide located within the following region: VKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLASIKKEQETVLL |