Antibodies

Jump to Filters
View as table Download
Troponin I fast skeletal muscle (TNNI2) (N-term) Rabbit Polyclonal Antibody
AP54323PU-N

USD 580.00

2 Weeks

Troponin I fast skeletal muscle (TNNI2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TNNI2
Troponin I fast skeletal muscle (TNNI2) Rabbit Polyclonal Antibody
TA318719

USD 535.00

In Stock

Anti-TNNI2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TNNI2 antibody was raised against synthetic peptide
Troponin I fast skeletal muscle (TNNI2) Rabbit Polyclonal Antibody
TA310134

USD 360.00

3 Weeks

Rabbit anti-TNNI2 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
Troponin I fast skeletal muscle (TNNI2) Rabbit Polyclonal Antibody
TA339170

USD 485.00

5 Days

Rabbit Polyclonal Anti-TNNI2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNI2 antibody: synthetic peptide directed towards the N terminal of human TNNI2. Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL