Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TRIM25 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-400 of human TRIM25 (NP_005073.2). |
| Modifications | Unmodified |
TRIM25 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human TRIM25 |
Rabbit polyclonal anti-ZNF147 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF147. |
TRIM25 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 360-418 of Human EFP. |
Rabbit polyclonal TRIM25 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TRIM25 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-306 amino acids from the Central region of human TRIM25. |
Rabbit Polyclonal Anti-TRIM25 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM25 antibody: synthetic peptide directed towards the middle region of human TRIM25. Synthetic peptide located within the following region: TPSSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGA |
Rabbit Polyclonal Anti-TRIM25 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM25 antibody: synthetic peptide directed towards the middle region of human TRIM25. Synthetic peptide located within the following region: LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT |
TRIM25 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM25 |
Active filters
Target Symbol
- TRIM25
Clonalities
- Polyclonal