Antibodies

View as table Download

SNAP47 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SNAP47

Rabbit Polyclonal Anti-CAT Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CAT antibody: synthetic peptide directed towards the middle region of human CAT. Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

SNAP47 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SNAP47

Rabbit Polyclonal Anti-C1orf142 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA