Rabbit Polyclonal Anti-PLXNA4 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLXNA4 |
Rabbit Polyclonal Anti-PLXNA4 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLXNA4 |
Rabbit Polyclonal Anti-PLXNA4 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLXNA4 antibody: synthetic peptide directed towards the middle region of human PLXNA4. Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV |