Rabbit polyclonal NFYB Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This NFYB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 17-46 amino acids from the N-terminal region of human NFYB. |
NFYB rabbit polyclonal antibody, Ig Fraction
| Applications | ELISA, EMSA, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | NF-Y (B subunit specific) peptide corresponding to a region near the N-terminus of the Human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal anti-NF-Y antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NF-Y (B subunit specific) peptide corresponding to a region near the N-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit Polyclonal anti-NFYB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYB antibody: synthetic peptide directed towards the middle region of human NFYB. Synthetic peptide located within the following region: EAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYT |
Rabbit Polyclonal Anti-NFYB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYB antibody: synthetic peptide directed towards the N terminal of human NFYB. Synthetic peptide located within the following region: MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKE |
Germany
Japan
United Kingdom
China
