Antibodies

Jump to Filters
View as table Download
MSRB3 Rabbit Polyclonal Antibody
TA378711

USD 365.00

3 Weeks

MSRB3 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human MSRB3 (NP_001026849.1).
Modifications Unmodified
MSRB3 Rabbit Polyclonal Antibody
TA357989

USD 539.00

5 Days

MSRB3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA