Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-IGF2BP3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 382-579 amino acids of human insulin-like growth factor 2 mRNA binding protein 3 |
Rabbit polyclonal anti-IF2B3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IGF2BP3. |
Goat Anti-IMP3 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Pig, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QRREDYTRYNQLSR, from the internal region of the protein sequence according to NP_060755.1. |
Rabbit Polyclonal Anti-IMP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IMP3 antibody: synthetic peptide directed towards the middle region of human IMP3. Synthetic peptide located within the following region: GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE |
IMP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human IMP3 |
Active filters
Target Symbol
- IMP3
Clonalities
- Polyclonal