Antibodies

Jump to Filters
View as table Download
IL36 gamma (IL36G) Rabbit Polyclonal Antibody
TA326667

USD 570.00

2 Weeks

Rabbit Polyclonal IL-36G Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-36G antibody was raised against a 13 amino acid peptide near the carboxy terminus of human IL-36G.
IL36 gamma (IL36G) Rabbit Polyclonal Antibody
TA308154

USD 625.00

In Stock

Rabbit Polyclonal antibody to IL1F9 (interleukin 1 family, member 9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 105 and 169 of IL1F9 (Uniprot ID#Q9NZH8)
IL36 gamma (IL36G) Rabbit Polyclonal Antibody
TA333744

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL36G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL36G Antibody is: synthetic peptide directed towards the middle region of Human IL36G. Synthetic peptide located within the following region: ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY