Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-IFIT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFIT1 antibody is: synthetic peptide directed towards the C-terminal region of Human IFIT1. Synthetic peptide located within the following region: ALELLKKALQETPTSVLLHHQIGLCYKAQMIQIKEATKGQPRGQNREKLD |
Rabbit polyclonal anti-IFIT1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IFIT1. |
Rabbit Polyclonal Anti-IFIT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IFIT1 antibody is: synthetic peptide directed towards the middle region of Human IFIT1. Synthetic peptide located within the following region: PFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSA |
IFIT1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFIT1 |
IFIT1 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from C-term domain of Human IFIT-1 |
Active filters
Target Symbol
- IFIT1
Clonalities
- Polyclonal