Rabbit Polyclonal Anti-NEDD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH |
Goat Polyclonal Antibody against NEDD9
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NKPQNKCDDLDR, from the internal region of the protein sequence according to NP_006394.1; NP_892011.2. |
Rabbit Polyclonal Anti-NEDD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NEDD9 |
Rabbit Polyclonal Anti-NEDD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTA |
Germany
Japan
United Kingdom
China
