galectin 9 (LGALS9) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from Human LEG9. Epitope: aa51-100 |
galectin 9 (LGALS9) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from Human LEG9. Epitope: aa51-100 |
galectin 9 (LGALS9) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 51-100 of Human Galectin-9. |
galectin 9 (LGALS9) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 61-90 amino acids from the N-terminal region of Human Galectin-9. |
Rabbit Polyclonal Anti-LGALS9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LGALS9 antibody is: synthetic peptide directed towards the middle region of Human LGALS9. Synthetic peptide located within the following region: YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV |
Rabbit Polyclonal Anti-LGALS9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LGALS9 antibody: synthetic peptide directed towards the middle region of human LGALS9. Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH |
Rabbit Polyclonal Anti-LEG9 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEG9 Antibody: A synthesized peptide derived from human LEG9 |