Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CHCHD3 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_060282.1. |
Goat Anti-CHCHD3 (aa151-164) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Sheep) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSSEFYRVTTEQYQ, from the internal region of the protein sequence according to NP_060282.1. |
Rabbit Polyclonal Anti-CHCHD3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHCHD3 antibody: synthetic peptide directed towards the middle region of human CHCHD3. Synthetic peptide located within the following region: LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY |
Rabbit Polyclonal Anti-CHCHD3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHCHD3 antibody: synthetic peptide directed towards the N terminal of human CHCHD3. Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR |
Active filters
Target Symbol
- CHCHD3
Clonalities
- Polyclonal