Antibodies

View as table Download

TCF3 / E2A (TCF3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-TCF3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TCF3.

Goat Polyclonal Antibody against TCF3 / ITF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KAPRARTSPDEDED, from the internal region of the protein sequence according to NP_003191.1.

Rabbit polyclonal anti-Transcription Factor 3 (E2A Immunoglobulin Enhancer Binding Factors E12/E47) antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human E2A.

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the C terminal of human TCF3. Synthetic peptide located within the following region: EENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVAN

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF3 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF3. Synthetic peptide located within the following region: EDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGG

Rabbit Polyclonal Anti-TCF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the N terminal of human TCF3. Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL

Rabbit polyclonal Transcription Factor 3 / E2A (Thr355) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human E2A around the phosphorylation site of threonine 355 (P-S-TP-P-V).
Modifications Phospho-specific