Antibodies

Jump to Filters
View as table Download
ORP150 (HYOU1) Rabbit Polyclonal Antibody
TA339043

USD 539.00

5 Days

Rabbit Polyclonal Anti-HYOU1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HYOU1 antibody: synthetic peptide directed towards the middle region of human HYOU1. Synthetic peptide located within the following region: DREVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQT
ORP150 (HYOU1) Rabbit Polyclonal Antibody
TA354517

USD 420.00

5 Days

Rabbit anti HYOU1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide next to the C-terminus of HYOU1 protein. This sequence is identical to rat, mouse, human and dog, bovine and horse origins.