Rabbit Polyclonal Anti-Lingo2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Lingo2 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Lingo2. Synthetic peptide located within the following region: KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG |
Rabbit Polyclonal Anti-LINGO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LINGO2 Antibody is: synthetic peptide directed towards the N-terminal region of Human LINGO2. Synthetic peptide located within the following region: ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL |
LINGO2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 370-540 of human LINGO2 (NP_689783.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China