Germany
Japan
United Kingdom
China
Antibodies
View as table Download
E2F1 (acetyl K120/K125) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from internal domain of Human E2F-1 protein containing acetyl lysine 120 and 125 |
Rabbit polyclonal E2F-1 phospho S364 antibody
| Applications | IHC, WB |
| Reactivities | Human, Chimpanzee |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 360-369 of Human E2F-1. |
E2F1 pSer337 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S337 of human E2F1. |
E2F1 (acetyl K120/K125) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from internal domain of human E2F-1 protein containing acetyl lysine 120 and 125 |
Rabbit Polyclonal E2F1 (Thr433) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human E2F1 around the phosphorylation site of Threonine 433 |
| Modifications | Phospho-specific |
Rabbit Polyclonal E2F1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human E2F1 |
Rabbit Polyclonal Anti-E2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the N terminal of human E2F1. Synthetic peptide located within the following region: PARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWA |
E2F1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding S332 of human E2F1. |
E2F1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding H357 of human E2F1. |
E2f (480-493) goat polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_524437.2. |
Goat Polyclonal Anti-Transcription factor E2F1 (aa314-327) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_005216.1 (QEVTSEEENRATDS) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- E2F1
Clonalities
- Polyclonal