Antibodies

Jump to Filters
View as table Download
TMX2 Rabbit Polyclonal Antibody
TA382633

USD 365.00

3 Weeks

TMX2 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 128-296 of human TMX2 (NP_057043.1).
TMX2 Rabbit Polyclonal Antibody
TA341991

USD 539.00

5 Days

Rabbit Polyclonal Anti-Tmx2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tmx2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tmx2. Synthetic peptide located within the following region: IRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEKPV