Antibodies

Jump to Filters
View as table Download
BOLA1 Rabbit Polyclonal Antibody
TA365525

USD 380.00

4 Weeks

BOLA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
BOLA1 Rabbit Polyclonal Antibody
TA369836

USD 380.00

4 Weeks

BOLA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
Bola1 Rabbit Polyclonal Antibody
TA329941

USD 539.00

5 Days

Rabbit Polyclonal Anti-Bola1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1. Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE