Antibodies

View as table Download

Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1).

SYVN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SYVN1 (NP_757385.1).
Modifications Unmodified

Goat Polyclonal Anti-SYVN1 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen internal region of NP_115807.1; NP_757385.1 (HERQHLEARLQS)

Rabbit Polyclonal Anti-SYVN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the middle region of human SYVN1. Synthetic peptide located within the following region: QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA

Rabbit Polyclonal Anti-SYVN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the C terminal of human SYVN1. Synthetic peptide located within the following region: ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV

Goat Polyclonal Anti-FCRL1 (aa165-177) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FCRL1 (aa165-177) Antibody: Peptide with sequence C-TAEYEIPSVRESD, from the internal region of the protein sequence according to NP_443170.1; NP_001152869.1; NP_001152870.1.