Antibodies

Jump to Filters
View as table Download
HAGH Rabbit Polyclonal Antibody
TA334983

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-HAGH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAGH antibody: synthetic peptide directed towards the C terminal of human HAGH. Synthetic peptide located within the following region: STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD
HAGH Rabbit Polyclonal Antibody
TA376913

USD 365.00

3 Weeks

HAGH Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human HAGH (NP_001035517.1).
Modifications Unmodified
HAGH Rabbit Polyclonal Antibody
TA334982

USD 539.00

5 Days

Rabbit Polyclonal Anti-HAGH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAGH antibody: synthetic peptide directed towards the C terminal of human HAGH. Synthetic peptide located within the following region: FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT