Antibodies

Jump to Filters
View as table Download
ACAA1 Rabbit Polyclonal Antibody
TA346554

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACAA1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
ACAA1 Rabbit Polyclonal Antibody
TA373170

USD 365.00

3 Weeks

ACAA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-300 of human ACAA1 (NP_001598.1).
Modifications Unmodified