Rabbit Polyclonal Antibody against GBL (Center)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This GBL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 140-170 amino acids from the Central region of human GBL. |
MLST8 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MLST8 |
Rabbit Polyclonal Anti-GBL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GBL antibody: synthetic peptide directed towards the middle region of human GBL. Synthetic peptide located within the following region: CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL |
Germany
Japan
United Kingdom
China
