Antibodies

Jump to Filters
View as table Download
GLS2 Rabbit Polyclonal Antibody
TA319893

USD 570.00

2 Weeks

Rabbit Polyclonal GLS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2.
GLS2 Rabbit Polyclonal Antibody
TA336821

USD 550.00

5 Days

Rabbit Polyclonal GLS2 Antibody

Applications ELISA, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody was raised against a 18 amino acid peptide near the center terminus of human GLS2 (NP_037399).
GLS2 Rabbit Polyclonal Antibody
TA331991

USD 485.00

5 Days

Rabbit Polyclonal Anti-GLS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLS2 Antibody: synthetic peptide directed towards the middle region of human GLS2. Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF