Antibodies

Jump to Filters
View as table Download
Methylmalonyl Coenzyme A mutase (MUT) Rabbit Polyclonal Antibody
TA335135

USD 539.00

5 Days

Rabbit polyclonal Anti-Mut Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mut antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mut. Synthetic peptide located within the following region: LAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGP
Methylmalonyl Coenzyme A mutase (MUT) Rabbit Polyclonal Antibody
TA361875

USD 539.00

5 Days

MUT Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MUT