Antibodies

Jump to Filters
View as table Download
HLA-DQA2 Goat Polyclonal Antibody
TA311486

USD 520.00

5 Days

Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2.
HLA-DQA2 Rabbit Polyclonal Antibody
TA331096

USD 539.00

5 Days

Rabbit polyclonal Anti-HLA-DQA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS
HLA-DQA2 Rabbit Polyclonal Antibody
TA331097

USD 539.00

5 Days

Rabbit polyclonal Anti-HLA-DQA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK