Antibodies

Jump to Filters
View as table Download
CYP2C18 Rabbit Polyclonal Antibody
TA313723

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19.
CYP2C18 (C-term) Rabbit Polyclonal Antibody
AP17966PU-N

USD 580.00

2 Weeks

CYP2C18 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2C18
CYP2C18 Rabbit Polyclonal Antibody
TA346226

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP2C18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM