Antibodies

Jump to Filters
View as table Download
ATG4C Rabbit Polyclonal Antibody
TA311707

USD 380.00

In Stock

Rabbit polyclonal anti-ATG4C antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATG4C.
ATG4C Goat Polyclonal Antibody
TA321018

USD 520.00

5 Days

Goat Polyclonal Anti-ATG4C Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen C- terminus of NP_116241.2; NP_835739.1 (EDEKKQLKRFSTEE)
ATG4C Rabbit Polyclonal Antibody
TA344180

USD 539.00

5 Days

Rabbit Polyclonal Anti-ATG4C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4C antibody: synthetic peptide directed towards the middle region of human ATG4C. Synthetic peptide located within the following region: TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS