Antibodies

Jump to Filters
View as table Download
PSMA4 Goat Polyclonal Antibody
AP21301PU-N

USD 520.00

5 Days

PSMA4 goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_002780.1 and NP_001096138.1
PSMA4 Rabbit Polyclonal Antibody
TA332532

USD 365.00

3 Weeks

Rabbit anti-PSMA4 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMA4
PSMA4 Rabbit Polyclonal Antibody
TA335912

USD 539.00

5 Days

Rabbit Polyclonal Anti-PSMA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PSMA4 Antibody: synthetic peptide directed towards the N terminal of human PSMA4. Synthetic peptide located within the following region: PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN