Antibodies

Jump to Filters
View as table Download
HCCS Rabbit Polyclonal Antibody
TA313998

USD 380.00

4 Weeks

Rabbit polyclonal Cytochrome c-type Heme Lyase antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CCHL.
HCCS (Center) Rabbit Polyclonal Antibody
AP52011PU-N

USD 580.00

2 Weeks

HCCS (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 179~209 amino acids from the Central region of human HCCS / CCHL
HCCS Rabbit Polyclonal Antibody
TA343104

USD 539.00

5 Days

Rabbit Polyclonal Anti-HCCS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HCCS antibody: synthetic peptide directed towards the C terminal of human HCCS. Synthetic peptide located within the following region: PRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTIL
HCCS Rabbit Polyclonal Antibody
TA357794

USD 539.00

5 Days

HCCS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated