Antibodies

Jump to Filters
View as table Download
XPF (ERCC4) Rabbit Polyclonal Antibody
TA312204

USD 380.00

4 Weeks

Rabbit polyclonal anti-XPF antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human XPF.
XPF (ERCC4) Rabbit Polyclonal Antibody
TA344393

USD 539.00

5 Days

Rabbit Polyclonal Anti-ERCC4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC4 antibody: synthetic peptide directed towards the middle region of human ERCC4. Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
XPF (ERCC4) Rabbit Polyclonal Antibody
TA347507

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-XPF Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-XPF Antibody: A synthesized peptide derived from human XPF